SCOPe 2.03: Domain d3zmla2: 3zml A:87-221

Lineage for d3zmla2 (3zml A:87-221)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Anopheles funestus [TaxId:62324] [236281] (2 PDB entries)

8. Domain d3zmla2: 3zml A:87-221 [236290]
   Other proteins in same PDB: d3zmla1, d3zmlb1
   automated match to d2il3a2
   complexed with gsh

Details for d3zmla2

PDB Entry: 3zml, 1.64 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa

PDB Compounds: (A:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmla2:

Sequence; same for both SEQRES and ATOM records:

>d3zmla2 a.45.1.0 (A:87-221) automated matches {Anopheles funestus [TaxId: 62324]}
pkdpvqqarvnaalhfesgvlfarmrfiferilfygksdipedrieyvqksyrlledtlk
ddfvagskmtiadfscistissimgvvpleqsehpriyewidrlkqlpyyeeanggggtd
lgkfvlakkeenaka

Timeline for d3zmla2:

• d3zmla2 is new in SCOPe 2.03-stable
  
• d3zmla2 appears in SCOPe 2.04
  
• d3zmla2 appears in the current release, SCOPe 2.08