SCOPe 2.03: Domain d3zmkc1: 3zmk C:3-86

Lineage for d3zmkc1 (3zmk C:3-86)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Anopheles funestus [TaxId:62324] [236279] (2 PDB entries)

8. Domain d3zmkc1: 3zmk C:3-86 [236280]
   Other proteins in same PDB: d3zmkb2, d3zmkc2, d3zmkd2
   automated match to d2il3a1
   complexed with gsh

Details for d3zmkc1

PDB Entry: 3zmk, 2.01 Å

PDB Description: Anopheles funestus glutathione-s-transferase epsilon 2 (GSTe2) protein structure from different alelles: A single amino acid change confers high level of DDT resistance and cross resistance to permethrin in a major malaria vector in Africa

PDB Compounds: (C:) glutathione s-transferase e2

SCOPe Domain Sequences for d3zmkc1:

Sequence, based on SEQRES records:

>d3zmkc1 c.47.1.0 (C:3-86) automated matches {Anopheles funestus [TaxId: 62324]}
klvlytlhlsppcraveltakalgleleqkninllagdhltpefmklnpqhtipvldddg
tiiteshaimiylvtkygkddtly

Sequence, based on observed residues (ATOM records):

>d3zmkc1 c.47.1.0 (C:3-86) automated matches {Anopheles funestus [TaxId: 62324]}
klvlytlhlsppcraveltakalgleleqkninipvldddgtiiteshaimiylvtkygk
ddtly

Timeline for d3zmkc1:

• d3zmkc1 is new in SCOPe 2.03-stable
  
• d3zmkc1 appears in SCOPe 2.04
  
• d3zmkc1 appears in the current release, SCOPe 2.08