Lineage for d3we1b_ (3we1 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2039515Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2039516Protein automated matches [190226] (55 species)
    not a true protein
  7. 2039604Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries)
  8. 2039606Domain d3we1b_: 3we1 B: [236278]
    automated match to d1s6na_

Details for d3we1b_

PDB Entry: 3we1 (more details), 2.28 Å

PDB Description: crystal structure of dengue 4 envelope protein domain iii (ed3)
PDB Compounds: (B:) Envelope protein E

SCOPe Domain Sequences for d3we1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3we1b_ b.1.18.0 (B:) automated matches {Dengue virus type 4 [TaxId: 408871]}
sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl
aentnsvtnieleppfgdsyivigvgnsaltlhwfrk

SCOPe Domain Coordinates for d3we1b_:

Click to download the PDB-style file with coordinates for d3we1b_.
(The format of our PDB-style files is described here.)

Timeline for d3we1b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3we1a_