Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (43 species) not a true protein |
Species Dengue virus type 4 [TaxId:408871] [236276] (2 PDB entries) |
Domain d3we1b_: 3we1 B: [236278] automated match to d1s6na_ |
PDB Entry: 3we1 (more details), 2.28 Å
SCOPe Domain Sequences for d3we1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3we1b_ b.1.18.0 (B:) automated matches {Dengue virus type 4 [TaxId: 408871]} sytmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisstpl aentnsvtnieleppfgdsyivigvgnsaltlhwfrk
Timeline for d3we1b_: