SCOPe 2.03: Domain d4nlqa_: 4nlq A:

Lineage for d4nlqa_ (4nlq A:)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)

6. Protein automated matches [190260] (21 species)
   not a true protein

7. Species Human poliovirus 1 [TaxId:12081] [193135] (16 PDB entries)

8. Domain d4nlqa_: 4nlq A: [236248]
   automated match to d3ddka_
   complexed with 1pe, acy, na; mutant

Details for d4nlqa_

PDB Entry: 4nlq, 2.3 Å

PDB Description: Poliovirus Polymerase - C290F Loop Mutant

PDB Compounds: (A:) RNA-directed RNA polymerase 3D-POL

SCOPe Domain Sequences for d4nlqa_:

Sequence; same for both SEQRES and ATOM records:

>d4nlqa_ e.8.1.4 (A:) automated matches {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgfsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

Timeline for d4nlqa_:

• d4nlqa_ is new in SCOPe 2.03-stable
  
• d4nlqa_ appears in SCOPe 2.04
  
• d4nlqa_ appears in the current release, SCOPe 2.08