SCOPe 2.05: Domain d4n9ob_: 4n9o B:

Lineage for d4n9ob_ (4n9o B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (93 PDB entries)

8. Domain d4n9ob_: 4n9o B: [236230]
   automated match to d2xa3a_

Details for d4n9ob_

PDB Entry: 4n9o, 1.5 Å

PDB Description: Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion protein bound to a Nanobody

PDB Compounds: (B:) Nanobody Nb484

SCOPe Domain Sequences for d4n9ob_:

Sequence; same for both SEQRES and ATOM records:

>d4n9ob_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
aaqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvss

Timeline for d4n9ob_:

• d4n9ob_ first appeared in SCOPe 2.03
  
• d4n9ob_ appears in SCOPe 2.04
  
• d4n9ob_ is called d4n9ob1 in SCOPe 2.06
  
• d4n9ob_ appears in the current release, SCOPe 2.08, called d4n9ob1