SCOPe 2.08: Domain d4n9ob1: 4n9o B:1-123

Lineage for d4n9ob1 (4n9o B:1-123)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d4n9ob1: 4n9o B:1-123 [236230]
   Other proteins in same PDB: d4n9ob2
   automated match to d2xa3a_

Details for d4n9ob1

PDB Entry: 4n9o, 1.5 Å

PDB Description: Probing the N-terminal beta-sheet conversion in the crystal structure of the human prion protein bound to a Nanobody

PDB Compounds: (B:) Nanobody Nb484

SCOPe Domain Sequences for d4n9ob1:

Sequence; same for both SEQRES and ATOM records:

>d4n9ob1 b.1.1.1 (B:1-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
aaqlqesggglvqpggslrlscaasgrtfssynmgwfrqapgkgrefvasitssgdksdy
tdsvkgrftisrdnakntmylqmnnlkpedtatyycarglgiyiirarggydhwgqgtqv
tvs

Timeline for d4n9ob1:

• d4n9ob1 first appeared in SCOPe 2.03, called d4n9ob_
  
• d4n9ob1 appears in SCOPe 2.07