Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein L (light) subunit [81477] (3 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [81475] (62 PDB entries) Uniprot P02954 |
Domain d4n7ll_: 4n7l L: [236228] Other proteins in same PDB: d4n7lh1, d4n7lh2, d4n7lm_ automated match to d1qovl_ complexed with 2go, cdl, fe, ggd, gol, hto, lda, pc1, po4, spo, u10 |
PDB Entry: 4n7l (more details), 2.85 Å
SCOPe Domain Sequences for d4n7ll_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4n7ll_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides [TaxId: 1063]} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d4n7ll_: