Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (57 species) not a true protein |
Species Borrelia burgdorferi [TaxId:224326] [236221] (1 PDB entry) |
Domain d4n13a_: 4n13 A: [236222] automated match to d1twyb_ complexed with edo, so4 |
PDB Entry: 4n13 (more details), 1.3 Å
SCOPe Domain Sequences for d4n13a_:
Sequence, based on SEQRES records: (download)
>d4n13a_ c.94.1.0 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]} ekivsiggsttvspildemilrydkinnntkvtydaqgssvginglfnkiykiaissrdl tkeeieqgaketvfaydalifitspeikitniteenlakilngeiqnwkqvggpdakinf inrdsssgsyssikdlllnkifktheeaqfrqdgivvksngeviektsltphsigyiglg yaknsiekglnilsvnstyptketinsnkytikrnliivtnnkyedksvtqfidfmtsst gqdiveeqgflgikt
>d4n13a_ c.94.1.0 (A:) automated matches {Borrelia burgdorferi [TaxId: 224326]} ekivsiggsttvspildemilrydkinnntkvtydaqgssvginglfnkiykiaissrdl tkeeieqgaketvfaydalifitspeikitniteenlakilngeiqnwkqvggpdakinf inrdsssgsyssikdlllnkifktheeaqfrqdgivvksngeviektsltphsigyiglg yaknsiekglnilsvnstyptketinsnkytikrnliivtnyedksvtqfidfmtsstgq diveeqgflgikt
Timeline for d4n13a_: