Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species) PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase |
Species Human (Homo sapiens) [TaxId:9606] [111195] (28 PDB entries) Uniprot Q08881 357-619 |
Domain d4l7sa_: 4l7s A: [236195] automated match to d4kioc_ complexed with g7k, so4; mutant |
PDB Entry: 4l7s (more details), 2.03 Å
SCOPe Domain Sequences for d4l7sa_:
Sequence, based on SEQRES records: (download)
>d4l7sa_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle eacvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsr yssksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhc wkerpedrpafsrllrqlaeiaesgl
>d4l7sa_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} gsvidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmkls hpklvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayle eacvihrdlaarnclvgenqvikvsdfgmtpvkwaspevfsfsryssksdvwsfgvlmwe vfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllr qlaeiaesgl
Timeline for d4l7sa_: