Lineage for d3zhgb_ (3zhg B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002670Species Mouse (Mus musculus) [TaxId:10090] [187331] (26 PDB entries)
  8. 3002696Domain d3zhgb_: 3zhg B: [236105]
    automated match to d1t8da1
    complexed with ca, so4

Details for d3zhgb_

PDB Entry: 3zhg (more details), 1.87 Å

PDB Description: crystallographic structure of the native mouse sign-r1 crd domain
PDB Compounds: (B:) cd209 antigen-like protein b

SCOPe Domain Sequences for d3zhgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zhgb_ d.169.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lcrlcpwdwtfllgncyffsksqrnwndavtackevkaqlviinsdeeqtflqqtskakg
ptwmglsdlkkeatwlwvdgstlssrfqkywnrgepnnigeedcvefagdgwndskcelk
kfwickksatpc

SCOPe Domain Coordinates for d3zhgb_:

Click to download the PDB-style file with coordinates for d3zhgb_.
(The format of our PDB-style files is described here.)

Timeline for d3zhgb_: