Lineage for d4mpmb_ (4mpm B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688341Protein Neuroglobin [100978] (2 species)
  7. 2688342Species Human (Homo sapiens) [TaxId:9606] [100979] (2 PDB entries)
  8. 2688344Domain d4mpmb_: 4mpm B: [236061]
    automated match to d1oj6b_
    complexed with hem

Details for d4mpmb_

PDB Entry: 4mpm (more details), 1.74 Å

PDB Description: Wild-type human neuroglobin
PDB Compounds: (B:) neuroglobin

SCOPe Domain Sequences for d4mpmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mpmb_ a.1.1.2 (B:) Neuroglobin {Human (Homo sapiens) [TaxId: 9606]}
erpepelirqswravsrsplehgtvlfarlfalepdllplfqyncrqfsspedclsspef
ldhirkvmlvidaavtnvedlssleeylaslgrkhravgvklssfstvgesllymlekcl
gpaftpatraawsqlygavvqamsrgwd

SCOPe Domain Coordinates for d4mpmb_:

Click to download the PDB-style file with coordinates for d4mpmb_.
(The format of our PDB-style files is described here.)

Timeline for d4mpmb_: