Lineage for d4ki5d2 (4ki5 D:107-213)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2034983Domain d4ki5d2: 4ki5 D:107-213 [236050]
    Other proteins in same PDB: d4ki5f2, d4ki5m_
    automated match to d1n0xl2

Details for d4ki5d2

PDB Entry: 4ki5 (more details), 2.47 Å

PDB Description: Cystal structure of human factor VIII C2 domain in a ternary complex with murine inhbitory antibodies 3E6 and G99
PDB Compounds: (D:) murine monoclonal 3e6 fab light chain

SCOPe Domain Sequences for d4ki5d2:

Sequence, based on SEQRES records: (download)

>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Sequence, based on observed residues (ATOM records): (download)

>d4ki5d2 b.1.1.0 (D:107-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathstspivksfnrnec

SCOPe Domain Coordinates for d4ki5d2:

Click to download the PDB-style file with coordinates for d4ki5d2.
(The format of our PDB-style files is described here.)

Timeline for d4ki5d2: