SCOPe 2.03: Domain d4l1fb2: 4l1f B:229-380

Lineage for d4l1fb2 (4l1f B:229-380)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (15 species)
   not a true protein

7. Species Acidaminococcus fermentans [TaxId:591001] [236043] (1 PDB entry)

8. Domain d4l1fb2: 4l1f B:229-380 [236046]
   Other proteins in same PDB: d4l1fa1, d4l1fb1
   automated match to d4o5md2
   complexed with cos, fad, na, pdo, po4

Details for d4l1fb2

PDB Entry: 4l1f, 1.79 Å

PDB Description: Electron transferring flavoprotein of Acidaminococcus fermentans: Towards a mechanism of flavin-based electron bifurcation

PDB Compounds: (B:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d4l1fb2:

Sequence; same for both SEQRES and ATOM records:

>d4l1fb2 a.29.3.0 (B:229-380) automated matches {Acidaminococcus fermentans [TaxId: 591001]}
gegfkiametldggrigvaaqalgiaegalaaavkyskereqfgrsiskfqalqfmmadm
atkieaarylvyhaamlknegkpyseaaamakcfasdvamevttdavqifggygytvdyp
aerymrnakitqiyegtnqvmrivtsrallrd

Timeline for d4l1fb2:

• d4l1fb2 is new in SCOPe 2.03-stable
  
• d4l1fb2 appears in SCOPe 2.04
  
• d4l1fb2 appears in the current release, SCOPe 2.08