Lineage for d4ktna_ (4ktn A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667912Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 1667918Domain d4ktna_: 4ktn A: [236040]
    automated match to d4geea_
    protein/DNA complex; complexed with mju

Details for d4ktna_

PDB Entry: 4ktn (more details), 1.69 Å

PDB Description: dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor ((3s)-1-[2-(pyrido[2,3-b]pyrazin-7-ylsulfanyl)-9h-pyrimido[4,5-b]indol-4-yl]pyrrolidin-3-amine)
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4ktna_:

Sequence, based on SEQRES records: (download)

>d4ktna_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
flnrglhisiedrregqedkkeyhyegleh

Sequence, based on observed residues (ATOM records): (download)

>d4ktna_ d.122.1.0 (A:) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhgvgssvvnalstsldvrvykdgkvyyqeyrrgavvd
dlkvieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregq
edkkeyhyegleh

SCOPe Domain Coordinates for d4ktna_:

Click to download the PDB-style file with coordinates for d4ktna_.
(The format of our PDB-style files is described here.)

Timeline for d4ktna_: