Lineage for d4ksha1 (4ksh A:18-224)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213594Species Enterococcus faecalis [TaxId:226185] [226590] (9 PDB entries)
  8. 2213601Domain d4ksha1: 4ksh A:18-224 [236039]
    Other proteins in same PDB: d4ksha2
    automated match to d4geea_
    protein/DNA complex; complexed with gol, htt

Details for d4ksha1

PDB Entry: 4ksh (more details), 1.7 Å

PDB Description: dna gyrase atp binding domain of enterococcus faecalis in complex with a small molecule inhibitor (7-({4-[(3r)-3-aminopyrrolidin-1-yl]-5-chloro-6-ethyl-7h-pyrrolo[2,3-d]pyrimidin-2-yl}sulfanyl)-1,5-naphthyridin-1(4h)-ol)
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d4ksha1:

Sequence, based on SEQRES records: (download)

>d4ksha1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhaggkfggggykvsgglhgvgssvvnalstsldvrvy
kdgkvyyqeyrrgavvddlkvieetdrhgttvhfipdpeiftettvydfdklatrvrela
flnrglhisiedrregqedkkeyhyeg

Sequence, based on observed residues (ATOM records): (download)

>d4ksha1 d.122.1.0 (A:18-224) automated matches {Enterococcus faecalis [TaxId: 226185]}
gleavrkrpgmyigstsgeglhhlvweivdnsidealagfaksiqviiepddsitviddg
rgipvgiqaktgrpavetvftvlhgvgssvvnalstsldvrvykdgkvyyqeyrrgavvd
dlkvieetdrhgttvhfipdpeiftettvydfdklatrvrelaflnrglhisiedrregq
edkkeyhyeg

SCOPe Domain Coordinates for d4ksha1:

Click to download the PDB-style file with coordinates for d4ksha1.
(The format of our PDB-style files is described here.)

Timeline for d4ksha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ksha2