SCOPe 2.08: Domain d1a45a1: 1a45 A:1-84

Lineage for d1a45a1 (1a45 A:1-84)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Cow (Bos taurus), isoform F [TaxId:9913] [49701] (1 PDB entry)

8. Domain d1a45a1: 1a45 A:1-84 [23602]

Details for d1a45a1

PDB Entry: 1a45, 2.3 Å

PDB Description: gammaf crystallin from bovine lens

PDB Compounds: (A:) gammaf crystallin

SCOPe Domain Sequences for d1a45a1:

Sequence; same for both SEQRES and ATOM records:

>d1a45a1 b.11.1.1 (A:1-84) gamma-Crystallin {Cow (Bos taurus), isoform F [TaxId: 9913]}
gkitfyedrgfqgrhyecssdhsnlqpyfsrcnsirvdsgcwmlyeqpnfqgpqyflrrg
dypdyqqwmglndsirscrlipht

Timeline for d1a45a1:

• d1a45a1 first appeared (with stable ids) in SCOP 1.55, called d1a45_1
  
• d1a45a1 appears in SCOPe 2.07