SCOPe 2.08: Domain d4c29b_: 4c29 B:

Lineage for d4c29b_ (4c29 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)

6. Protein automated matches [190060] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (22 PDB entries)

8. Domain d4c29b_: 4c29 B: [235983]
   automated match to d4c29a_
   complexed with act, ca, peg; mutant

Details for d4c29b_

PDB Entry: 4c29, 2.2 Å

PDB Description: Crystal Structure of High-Affinity von Willebrand Factor A1 domain with Disulfide Mutation

PDB Compounds: (B:) von willebrand factor

SCOPe Domain Sequences for d4c29b_:

Sequence; same for both SEQRES and ATOM records:

>d4c29b_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plhdfcrsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgs
hayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllm
asqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvde
leqqrdeivsylcdlapeapp

Timeline for d4c29b_:

• d4c29b_ first appeared in SCOPe 2.03
  
• d4c29b_ appears in SCOPe 2.07