Class a: All alpha proteins [46456] (284 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.0: automated matches [191605] (1 protein) not a true family |
Protein automated matches [191104] (8 species) not a true protein |
Species Pleurotus ostreatus [TaxId:5322] [235966] (8 PDB entries) |
Domain d4bm1b_: 4bm1 B: [235969] automated match to d3q3ua_ complexed with ca, cit, hem, so4 |
PDB Entry: 4bm1 (more details), 1.1 Å
SCOPe Domain Sequences for d4bm1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bm1b_ a.93.1.0 (B:) automated matches {Pleurotus ostreatus [TaxId: 5322]} akcskgrtasndaccvwfdvlddiqenlfdggecgeevheslrltfhdaigfspaltrqg kfggggadgsimlfsdietnfaanngvddiveqqkpiaikhqvsfgdfiqfagavgssnc aggpriqflagrsnvtkpspdhlvpepfdsvtsilarmgdagfkpdevvallashsvaaq dtidpklaghpfdstpsdfdsqffvetllkgtlipgdslhkgqvksplpgefrlqsdell ardsrtscewqsfisnpnsmvpkferamakmatlgqnpkklidcsevipvprgrvkqptl pagktikdieascrkapfprlptdkgtftsilpvpss
Timeline for d4bm1b_: