SCOPe 2.03: Domain d4cjsb_: 4cjs B:

Lineage for d4cjsb_ (4cjs B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (62 PDB entries)

8. Domain d4cjsb_: 4cjs B: [235943]
   automated match to d4ah9a_
   complexed with act, cl, l0y, so4

Details for d4cjsb_

PDB Entry: 4cjs, 1.8 Å

PDB Description: Interrogating HIV integrase for compounds that bind- a SAMPL challenge

PDB Compounds: (B:) integrase

SCOPe Domain Sequences for d4cjsb_:

Sequence, based on SEQRES records:

>d4cjsb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d4cjsb_ c.55.3.2 (B:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
spgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvhtd
ngsnftsttvkaacwwagikqedgipynpqsqgviesmnkelkkiigqvrdqaehlktav
qmavfihnhkrgysagerivdiiatdiq

Timeline for d4cjsb_:

• d4cjsb_ is new in SCOPe 2.03-stable
  
• d4cjsb_ appears in SCOPe 2.04
  
• d4cjsb_ appears in the current release, SCOPe 2.08