SCOPe 2.06: Domain d3znya_: 3zny A:

Lineage for d3znya_ (3zny A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (23 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [188184] (5 PDB entries)

8. Domain d3znya_: 3zny A: [235921]
   automated match to d1ylpa_
   mutant

Details for d3znya_

PDB Entry: 3zny, 1.2 Å

PDB Description: crystal structure of the class a extended-spectrum beta-lactamase ctx-m-96, a natural d240g mutant derived from ctx-m-12

PDB Compounds: (A:) ctx-m-12a enzyme

SCOPe Domain Sequences for d3znya_:

Sequence; same for both SEQRES and ATOM records:

>d3znya_ e.3.1.1 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
dvqqklaelerqsggrlgvalintadnsqilyraderfamcstskvmaaaavlkksesep
sllnqrveikksdlvnynpiaekhvngtmslaelsaaalqysdnvamnkliahvggpasv
tafarqlgdetfrldrteptlntaipgdprdttspramaqtlrnltlgkalgdsqraqlv
twmkgnttgaasiqaglpaswvvgdktgsggygttndiaviwpkdraplilvtyftqpqp
kaesrrdilasaakivtdgl

Timeline for d3znya_:

• d3znya_ first appeared in SCOPe 2.03
  
• d3znya_ appears in SCOPe 2.05
  
• d3znya_ appears in SCOPe 2.07
  
• d3znya_ appears in the current release, SCOPe 2.08