Class b: All beta proteins [48724] (174 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins) coupled with a NADP-binding domain of alpha/beta class |
Protein automated matches [227029] (3 species) not a true protein |
Species Nostoc sp. [TaxId:1168] [229175] (3 PDB entries) |
Domain d3zc3b1: 3zc3 B:9-141 [235907] Other proteins in same PDB: d3zc3b2 automated match to d3zc3a1 complexed with fad, gol, nap; mutant |
PDB Entry: 3zc3 (more details), 2.3 Å
SCOPe Domain Sequences for d3zc3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zc3b1 b.43.4.2 (B:9-141) automated matches {Nostoc sp. [TaxId: 1168]} dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd kngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs evkitgpvgkeml
Timeline for d3zc3b1: