SCOPe 2.03: Domain d3zc3b1: 3zc3 B:9-141

Lineage for d3zc3b1 (3zc3 B:9-141)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein automated matches [227029] (3 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1168] [229175] (3 PDB entries)

8. Domain d3zc3b1: 3zc3 B:9-141 [235907]
   Other proteins in same PDB: d3zc3b2
   automated match to d3zc3a1
   complexed with fad, gol, nap; mutant

Details for d3zc3b1

PDB Entry: 3zc3, 2.3 Å

PDB Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization

PDB Compounds: (B:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zc3b1:

Sequence; same for both SEQRES and ATOM records:

>d3zc3b1 b.43.4.2 (B:9-141) automated matches {Nostoc sp. [TaxId: 1168]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

Timeline for d3zc3b1:

• d3zc3b1 is new in SCOPe 2.03-stable
  
• d3zc3b1 appears in SCOPe 2.04
  
• d3zc3b1 appears in the current release, SCOPe 2.08