SCOPe 2.03: Domain d4lndc_: 4lnd C:

Lineage for d4lndc_ (4lnd C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.1: DNase I-like [56220] (7 proteins)

6. Protein automated matches [190454] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187368] (5 PDB entries)

8. Domain d4lndc_: 4lnd C: [235890]
   automated match to d4lnda_
   complexed with mg

Details for d4lndc_

PDB Entry: 4lnd, 1.92 Å

PDB Description: Crystal structure of human apurinic/apyrimidinic endonuclease 1 with essential Mg2+ cofactor

PDB Compounds: (C:) DNA-(apurinic or apyrimidinic site) lyase

SCOPe Domain Sequences for d4lndc_:

Sequence; same for both SEQRES and ATOM records:

>d4lndc_ d.151.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyedppdqktspsgkpatlkicswnvdglrawikkkgldwvkeeapdilclqetkcsenk
lpaelqelpglshqywsapsdkegysgvgllsrqcplkvsygigdeehdqegrvivaefd
sfvlvtayvpnagrglvrleyrqrwdeafrkflkglasrkplvlcgdlnvaheeidlrnp
kgnkknagftpqerqgfgellqavpladsfrhlypntpyaytfwtymmnarsknvgwrld
yfllshsllpalcdskirskalgsdhcpitlylal

Timeline for d4lndc_:

• d4lndc_ is new in SCOPe 2.03-stable
  
• d4lndc_ appears in SCOPe 2.04
  
• d4lndc_ appears in the current release, SCOPe 2.08