SCOPe 2.03: Domain d4liwb_: 4liw B:

Lineage for d4liwb_ (4liw B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.56: CcmK-like [143414] (2 families)
   contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape

5. Family d.58.56.1: CcmK-like [143415] (4 proteins)
   Pfam PF00936; BMC domain

6. Protein automated matches [191074] (5 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [235887] (1 PDB entry)

8. Domain d4liwb_: 4liw B: [235889]
   automated match to d3cimc_
   complexed with so4; mutant

Details for d4liwb_

PDB Entry: 4liw, 1.6 Å

PDB Description: ccmk1 carboxysome shell protein from synechocystis pcc6803, l11k point mutant

PDB Compounds: (B:) Carbon dioxide-concentrating mechanism protein ccmK homolog 1

SCOPe Domain Sequences for d4liwb_:

Sequence; same for both SEQRES and ATOM records:

>d4liwb_ d.58.56.1 (B:) automated matches {Synechocystis sp. [TaxId: 1111708]}
iavgmietkgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlpil

Timeline for d4liwb_:

• d4liwb_ is new in SCOPe 2.03-stable
  
• d4liwb_ appears in SCOPe 2.04
  
• d4liwb_ appears in the current release, SCOPe 2.08, called d4liwb1