Lineage for d4lh6a_ (4lh6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979317Family d.142.2.2: Adenylation domain of NAD+-dependent DNA ligase [56096] (2 proteins)
    automatically mapped to Pfam PF01653
  6. 2979318Protein Adenylation domain of NAD+-dependent DNA ligase [56097] (4 species)
    contains additional, N-terminal all-alpha subdomain
  7. 2979322Species Enterococcus faecalis [TaxId:1351] [118124] (9 PDB entries)
    Uniprot Q837V6 5-317
  8. 2979326Domain d4lh6a_: 4lh6 A: [235886]
    automated match to d4lh7a_
    complexed with 1x7, act, na, nmn

Details for d4lh6a_

PDB Entry: 4lh6 (more details), 1.65 Å

PDB Description: Crystal structure of a LigA inhibitor
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d4lh6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lh6a_ d.142.2.2 (A:) Adenylation domain of NAD+-dependent DNA ligase {Enterococcus faecalis [TaxId: 1351]}
eqqpltltaattraqelrkqlnqysheyyvkdqpsvedyvydrlykelvdietefpdlit
pdsptqrvggkvlsgfekaphdipmyslndgfskedifafdervrkaigkpvayccelki
dglaislryengvfvrgatrgdgtvgenitenlrtvrsvpmrltepisvevrgecympkq
sfvalneereengqdifanprnaaagslrqldtkivakrnlntflytvadfgpmkaktqf
ealeelsaigfrtnperqlcqsidevwayieeyhekrstlpyeidgivikvnefalqdel
gftvkaprwaiaykfppeeaet

SCOPe Domain Coordinates for d4lh6a_:

Click to download the PDB-style file with coordinates for d4lh6a_.
(The format of our PDB-style files is described here.)

Timeline for d4lh6a_: