Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (20 species) not a true protein |
Species Oscillatoria sp. [TaxId:272129] [229249] (1 PDB entry) |
Domain d4irnd1: 4irn D:4-230 [235883] Other proteins in same PDB: d4irna2, d4irnb2, d4irnc2, d4irnd2, d4irne2, d4irnf2, d4irng2, d4irnh2 automated match to d4irnf1 complexed with fad |
PDB Entry: 4irn (more details), 2.8 Å
SCOPe Domain Sequences for d4irnd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4irnd1 e.6.1.0 (D:4-230) automated matches {Oscillatoria sp. [TaxId: 272129]} awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgee
Timeline for d4irnd1: