Lineage for d4irne1 (4irn E:4-230)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1951081Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1951082Protein automated matches [226934] (20 species)
    not a true protein
  7. 1951185Species Oscillatoria sp. [TaxId:272129] [229249] (1 PDB entry)
  8. 1951190Domain d4irne1: 4irn E:4-230 [235875]
    Other proteins in same PDB: d4irna2, d4irnb2, d4irnc2, d4irnd2, d4irne2, d4irnf2, d4irng2, d4irnh2
    automated match to d4irnf1
    complexed with fad

Details for d4irne1

PDB Entry: 4irn (more details), 2.8 Å

PDB Description: Crystal Structure of the Prolyl Acyl Carrier Protein Oxidase AnaB
PDB Compounds: (E:) Prolyl-ACP dehydrogenase

SCOPe Domain Sequences for d4irne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4irne1 e.6.1.0 (E:4-230) automated matches {Oscillatoria sp. [TaxId: 272129]}
awnsqqiqfrkkviqfaqqslisdlikndkeeifnrdawqkcsefgvhgwpiparyggqe
ldilttayalqglgygckdnglifamnahiwacemplltfgteeqkekylpllcrggwia
shaatepqagsdiyslkttaqkdgdkyilngykhyvtngtiadlfiifatidpslgkegl
ttfmiekdtpglilskpiskmgmrtaevpelrlencevsaanrlgee

SCOPe Domain Coordinates for d4irne1:

Click to download the PDB-style file with coordinates for d4irne1.
(The format of our PDB-style files is described here.)

Timeline for d4irne1: