Lineage for d1dzla_ (1dzl A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11556Family b.10.1.4: Animal virus proteins [49656] (15 proteins)
  6. 11594Protein L1 protein [49692] (1 species)
  7. 11595Species Human papillomavirus type 16 [TaxId:333760] [49693] (1 PDB entry)
  8. 11596Domain d1dzla_: 1dzl A: [23586]

Details for d1dzla_

PDB Entry: 1dzl (more details), 3.5 Å

PDB Description: l1 protein of human papillomavirus 16

SCOP Domain Sequences for d1dzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dzla_ b.10.1.4 (A:) L1 protein {Human papillomavirus type 16}
kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd
mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked
plkkytfwevnlkekfsadldqfplgrkfllqlgl

SCOP Domain Coordinates for d1dzla_:

Click to download the PDB-style file with coordinates for d1dzla_.
(The format of our PDB-style files is described here.)

Timeline for d1dzla_: