Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.6: Group I dsDNA viruses [88648] (2 families) |
Family b.121.6.1: Papovaviridae-like VP [88649] (3 proteins) |
Protein Papillomavirus L1 protein [49692] (1 species) |
Species Human papillomavirus type 16 [TaxId:333760] [49693] (1 PDB entry) |
Domain d1dzla_: 1dzl A: [23586] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1dzl (more details), 3.5 Å
SCOPe Domain Sequences for d1dzla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dzla_ b.121.6.1 (A:) Papillomavirus L1 protein {Human papillomavirus type 16 [TaxId: 333760]} kvvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana gvdnrecismdykqtqlcligckppigehwgkgspctqvavqpgdcpplelintviqdgd mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc kitltadvmtyihsmnstiledwnfglqpppggtledtyrfvtsqaiacqkhtppapked plkkytfwevnlkekfsadldqfplgrkfllqlgl
Timeline for d1dzla_: