![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
![]() | Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
![]() | Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) |
![]() | Protein automated matches [235852] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [235853] (2 PDB entries) |
![]() | Domain d4c2ab_: 4c2a B: [235854] Other proteins in same PDB: d4c2aa_ automated match to d1p8va_ complexed with act, ca, cac, peg; mutant |
PDB Entry: 4c2a (more details), 2.08 Å
SCOPe Domain Sequences for d4c2ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4c2ab_ c.10.2.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpicevskvashlevncdkrrltalppdlpkdttilhlsenllytfslatlmpytrltql nldrceltklqvdgtlpvlgtldlshnqlqslpllgqtlpaltvldvsfnrltslplgal rglgelqelylkgnelktlppglltptpkleklslannrltelpagllnglenldtlllq enslytipkgffgshllpfaflhgnpwlcnceilyfrrwlqdnaenvyvwkqvvdvkavt snvasvqcdnsdkfpvykypgkgcpt
Timeline for d4c2ab_: