Class a: All alpha proteins [46456] (285 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (18 species) not a true protein |
Species Brucella suis [TaxId:204722] [230320] (1 PDB entry) |
Domain d4o5mc2: 4o5m C:229-382 [235846] Other proteins in same PDB: d4o5ma1, d4o5mb1, d4o5mc1, d4o5md1 automated match to d4o5md2 complexed with ca, pg5 |
PDB Entry: 4o5m (more details), 2.2 Å
SCOPe Domain Sequences for d4o5mc2:
Sequence, based on SEQRES records: (download)
>d4o5mc2 a.29.3.0 (C:229-382) automated matches {Brucella suis [TaxId: 204722]} gkgvnvlmsgldyervvlaggplgimaacldvvvpyvherkqfdqpigefqlmqckladm yvtfnasrayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyp tgrllrdaklyeigagtseirrmligrelfqetr
>d4o5mc2 a.29.3.0 (C:229-382) automated matches {Brucella suis [TaxId: 204722]} gkgvnvlmsgldyervvlaggplgimaacldvvvpyvhergefqlmqckladmyvtfnas rayvyavaaacdrgettrkdaagcilysaenatqmalqaiqslggngyindyptgrllrd aklyeigagtseirrmligrelfqetr
Timeline for d4o5mc2: