SCOPe 2.04: Domain d4o5mc1: 4o5m C:-3-228

Lineage for d4o5mc1 (4o5m C:-3-228)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (17 species)
   not a true protein

7. Species Brucella suis [TaxId:204722] [230318] (1 PDB entry)

8. Domain d4o5mc1: 4o5m C:-3-228 [235845]
   Other proteins in same PDB: d4o5ma2, d4o5mb2, d4o5mc2, d4o5md2
   automated match to d4o5md1
   complexed with ca, pg5

Details for d4o5mc1

PDB Entry: 4o5m, 2.2 Å

PDB Description: X-ray Crystal Structure of Isovaleryl-CoA Dehydrogenase from Brucella suis

PDB Compounds: (C:) isovaleryl-coa dehydrogenase

SCOPe Domain Sequences for d4o5mc1:

Sequence, based on SEQRES records:

>d4o5mc1 e.6.1.0 (C:-3-228) automated matches {Brucella suis [TaxId: 204722]}
hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
gehvgalamsepgagsdvvsmklaaekrgdryvlngnkmwitngpdadvlvvyaktdlsa
gprgisafiiekgfkgfstaqkldklgmrgsntcelvfedcevpaenllgte

Sequence, based on observed residues (ATOM records):

>d4o5mc1 e.6.1.0 (C:-3-228) automated matches {Brucella suis [TaxId: 204722]}
hhhhmnfglgeeiealrdtvrrfaesriaplaaetdrnnqfpmhlwrefgelgvlgitap
edyggagmgylahciameeisrasasiglsygahsnlcvnqitrngspeqrakylpklis
gehvgalamsmklaaekrgdryvlngnkmwitngpdadvlvvyaktdisafiiekgfkgf
staqkldklgmrgsntcelvfedcevpaenllgte

Timeline for d4o5mc1:

• d4o5mc1 first appeared in SCOPe 2.03
  
• d4o5mc1 appears in SCOPe 2.05
  
• d4o5mc1 appears in the current release, SCOPe 2.08