Lineage for d4o0ng_ (4o0n G:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1415050Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1415051Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1415295Protein automated matches [190032] (11 species)
    not a true protein
  7. 1415499Species Toxoplasma gondii [TaxId:508771] [230191] (1 PDB entry)
  8. 1415506Domain d4o0ng_: 4o0n G: [235840]
    automated match to d4o0na_
    complexed with so4

Details for d4o0ng_

PDB Entry: 4o0n (more details), 2.4 Å

PDB Description: 2.4 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii.
PDB Compounds: (G:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4o0ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o0ng_ d.58.6.1 (G:) automated matches {Toxoplasma gondii [TaxId: 508771]}
kqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpff
pglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgsd
svesankeislwftpeeicewtsaqhkwvyeq

SCOPe Domain Coordinates for d4o0ng_:

Click to download the PDB-style file with coordinates for d4o0ng_.
(The format of our PDB-style files is described here.)

Timeline for d4o0ng_: