Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries) |
Domain d4o0nd1: 4o0n D:3-155 [235834] Other proteins in same PDB: d4o0nb2, d4o0nd2, d4o0ne2, d4o0nf2 automated match to d4o0na_ complexed with so4 |
PDB Entry: 4o0n (more details), 2.4 Å
SCOPe Domain Sequences for d4o0nd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o0nd1 d.58.6.1 (D:3-155) automated matches {Toxoplasma gondii [TaxId: 508771]} akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs dsvesankeislwftpeeicewtsaqhkwvyeq
Timeline for d4o0nd1: