Lineage for d4o0nb_ (4o0n B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1907823Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1907824Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 protein domains)
  6. 1908074Protein automated matches [190032] (15 species)
    not a true protein
  7. 1908297Species Toxoplasma gondii [TaxId:508771] [230191] (2 PDB entries)
  8. 1908311Domain d4o0nb_: 4o0n B: [235832]
    automated match to d4o0na_
    complexed with so4

Details for d4o0nb_

PDB Entry: 4o0n (more details), 2.4 Å

PDB Description: 2.4 angstrom resolution crystal structure of putative nucleoside diphosphate kinase from toxoplasma gondii.
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4o0nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o0nb_ d.58.6.1 (B:) automated matches {Toxoplasma gondii [TaxId: 508771]}
akqqertyimvkpdgvqrglvsevirrfeqrgyklvalkmkspdatlleehyadlkgkpf
fpglisymtsgpvvcmvwegtdvvkqgrrmlgetrplesnpgtlrgdfcidvgrnivhgs
dsvesankeislwftpeeicewtsaqhkwvyeqg

SCOPe Domain Coordinates for d4o0nb_:

Click to download the PDB-style file with coordinates for d4o0nb_.
(The format of our PDB-style files is described here.)

Timeline for d4o0nb_: