Lineage for d4nu7d_ (4nu7 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827796Species Toxoplasma gondii [TaxId:5811] [229953] (1 PDB entry)
  8. 2827800Domain d4nu7d_: 4nu7 D: [235824]
    automated match to d4nu7b_
    complexed with cl, so4, zn

Details for d4nu7d_

PDB Entry: 4nu7 (more details), 2.05 Å

PDB Description: 2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.
PDB Compounds: (D:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d4nu7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nu7d_ c.1.2.0 (D:) automated matches {Toxoplasma gondii [TaxId: 5811]}
sqlkpiicpsvlasdlsslasdakrmvdagcdwlhldimdghfvpnisfgpgvvkalrgh
lksaffdvhlmvsepekwiqpfadagansitfhwesvggdlqraaelakriqargikagl
aikpatkfedlgealagdnfdmllvmtvepgfggqkfmadmlqkvrtarslfpklniqvd
ggldgetvkpaasaganvivagtsmfkaenpaalmtfmrdviaasd

SCOPe Domain Coordinates for d4nu7d_:

Click to download the PDB-style file with coordinates for d4nu7d_.
(The format of our PDB-style files is described here.)

Timeline for d4nu7d_: