Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (35 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225575] (8 PDB entries) |
Domain d4ni4h_: 4ni4 H: [235811] automated match to d4ni4d_ complexed with act, nad; mutant |
PDB Entry: 4ni4 (more details), 2.6 Å
SCOPe Domain Sequences for d4ni4h_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ni4h_ c.82.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 93062]} mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftgsietgkh imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag avfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegleeylvsk hiltntnpqlvnwfsk
Timeline for d4ni4h_: