Lineage for d4ni4h_ (4ni4 H:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621931Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1621932Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1622321Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 1622322Protein automated matches [190683] (35 species)
    not a true protein
  7. 1622726Species Staphylococcus aureus [TaxId:93062] [225575] (8 PDB entries)
  8. 1622752Domain d4ni4h_: 4ni4 H: [235811]
    automated match to d4ni4d_
    complexed with act, nad; mutant

Details for d4ni4h_

PDB Entry: 4ni4 (more details), 2.6 Å

PDB Description: 2.6 Angstrom resolution crystal structure of betaine aldehyde dehydrogenase (betB) G234S mutant from Staphylococcus aureus (IDP00699) in complex with NAD+ and BME-free Cys289
PDB Compounds: (H:) betaine aldehyde dehydrogenase

SCOPe Domain Sequences for d4ni4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ni4h_ c.82.1.0 (H:) automated matches {Staphylococcus aureus [TaxId: 93062]}
mellkhlsqrqyidgewvesankntrdiinpynqeviftvsegtkedaerailaarrafe
sgewsqetaetrgkkvraiadkikehrealarletldtgktleesyadmddihnvfmyfa
gladkdggemidspipdteskivkepvgvvtqitpwnypllqaswkiapalatgcslvmk
pseitplttirvfelmeevgfpkgtinlilgagsevgdvmsghkevdlvsftgsietgkh
imknaannvtnialelggknpniifddadfelavdqalnggyfhagqvcsagsrilvqns
ikdkfeqalidrvkkiklgngfdadtemgpvistehrnkiesymdvakaegatiavggkr
pdrddlkdglffeptvitncdtsmrivqeevfgpvvtvegfeteqeaiqlandsiyglag
avfskdigkaqrvanklklgtvwindfhpyfaqapwggykqsgigrelgkegleeylvsk
hiltntnpqlvnwfsk

SCOPe Domain Coordinates for d4ni4h_:

Click to download the PDB-style file with coordinates for d4ni4h_.
(The format of our PDB-style files is described here.)

Timeline for d4ni4h_: