SCOP 1.69: Domain d1tmf1_: 1tmf 1:

Lineage for d1tmf1_ (1tmf 1:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Theilovirus capsid proteins [49686] (1 species)

7. Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries)

8. Domain d1tmf1_: 1tmf 1: [23576]

Details for d1tmf1_

PDB Entry: 1tmf, 3.5 Å

PDB Description: three-dimensional structure of theiler murine encephalomyelitis virus (bean strain)

SCOP Domain Sequences for d1tmf1_:

Sequence; same for both SEQRES and ATOM records:

>d1tmf1_ b.121.4.1 (1:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da}
gvdnaekgkvsnddasvdfvaepvklpenqtrvaffydravpigmlrpgqnmettfnyqe
ndyrlncllltplpsfcpdsssgpqktkapvqwrwvrsggvnganfplmtkqdyaflcfs
pftfykcdlevtvsalgtdtvasvlrwaptgapadvtdqligytpslgetrnphmwlvga
gnsqvsfvvpynsplsvlpaawfngwsdfgntkdfgvapnadfgrlwiqgntsasvriry
kkmkvfcprptlffpwptptttkinadnpvpilele

Timeline for d1tmf1_:

• d1tmf1_ first appeared (with stable ids) in SCOP 1.55
  
• d1tmf1_ appears in SCOP 1.67
  
• d1tmf1_ appears in SCOP 1.71
  
• d1tmf1_ appears in the current release, SCOPe 2.08