SCOPe 2.03: Domain d4nbvb_: 4nbv B:

Lineage for d4nbvb_ (4nbv B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Cupriavidus taiwanensis [TaxId:164546] [229454] (1 PDB entry)

8. Domain d4nbvb_: 4nbv B: [235759]
   automated match to d4nbva_
   complexed with b3p

Details for d4nbvb_

PDB Entry: 4nbv, 1.65 Å

PDB Description: Crystal structure of FabG from Cupriavidus taiwanensis

PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] reductase putative short-chain dehydrogenases/reductases (SDR) family protein

SCOPe Domain Sequences for d4nbvb_:

Sequence; same for both SEQRES and ATOM records:

>d4nbvb_ c.2.1.0 (B:) automated matches {Cupriavidus taiwanensis [TaxId: 164546]}
mklqgrvaiitgaaagigfataqrfaedgaivvlcdvqearvreaaarlaatgatvsayr
vdvtrrdevdamvaavlaahqrvdilvnnagitkdarlakmteaqfdavidvnlkgvfnc
aqavaglmteqgkgvilnassvvglygnfgqtnyaaskfgvigftktwarelgpkgvrvn
avcpgfvnteilqtvpdkvldgmtsscwlrrlaepaeiasiyaflasddasyvngvaiea
sggmsl

Timeline for d4nbvb_:

• d4nbvb_ is new in SCOPe 2.03-stable
  
• d4nbvb_ appears in SCOPe 2.04
  
• d4nbvb_ appears in the current release, SCOPe 2.08