Lineage for d4navc_ (4nav C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920689Species Xanthomonas campestris [TaxId:190485] [228883] (1 PDB entry)
  8. 2920692Domain d4navc_: 4nav C: [235753]
    automated match to d4navd_

Details for d4navc_

PDB Entry: 4nav (more details), 2.69 Å

PDB Description: Crystal structure of hypothetical protein XCC2798 from Xanthomonas campestris, Target EFI-508608
PDB Compounds: (C:) hypothetical protein xcc279

SCOPe Domain Sequences for d4navc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4navc_ c.108.1.0 (C:) automated matches {Xanthomonas campestris [TaxId: 190485]}
mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
sa

SCOPe Domain Coordinates for d4navc_:

Click to download the PDB-style file with coordinates for d4navc_.
(The format of our PDB-style files is described here.)

Timeline for d4navc_: