Class b: All beta proteins [48724] (144 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Theilovirus capsid proteins [49686] (1 species) |
Species Theiler's murine encephalomyelitis virus, strain da [TaxId:12124] [49687] (2 PDB entries) |
Domain d1tme3_: 1tme 3: [23575] |
PDB Entry: 1tme (more details), 2.8 Å
SCOP Domain Sequences for d1tme3_:
Sequence, based on SEQRES records: (download)
>d1tme3_ b.121.4.1 (3:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da} spiavtvrehkgcfystnpdttvpiygktistpndymcgefsdllelcklptflgnpnsn nkrypyfsatnsvpttslvdyqvalscscmcnsmlaavarnfnqyrgslnflfvftgaam vkgkfliaytppgagkpttrdqamqatyaiwdlglnssfvftapfispthyrqtsytsat iasvdgwvtvwqltpltypsgtpvnsdiltlvsagddftlrmpisptkwvpq
>d1tme3_ b.121.4.1 (3:) Theilovirus capsid proteins {Theiler's murine encephalomyelitis virus, strain da} spiavtvrehkgcfystnpdttvpiygktistpndymcgefsdllelcklptflgnpnsn nkrypyfsatnsvpttslvdyqvalscscmcnsmlaavarnfnqyrgslnflfvftgaam vkgkfliaytppgagkpttrdqamqatyaiwdlglnssfvftapfispthyrqtsytsaa svdgwvtvwqltpltypsgtpvnsdiltlvsagddftlrmpisptkwvpq
Timeline for d1tme3_: