Lineage for d4n5nb_ (4n5n B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349962Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1349963Protein automated matches [190069] (159 species)
    not a true protein
  7. 1351023Species Ralstonia eutropha [TaxId:381666] [229715] (3 PDB entries)
  8. 1351029Domain d4n5nb_: 4n5n B: [235741]
    automated match to d4n5ma_
    complexed with nap

Details for d4n5nb_

PDB Entry: 4n5n (more details), 1.9 Å

PDB Description: Crystal structure of (R)-3-hydroxybutyryl-CoA dehydrogenase from Ralstonia eutropha in complexed with NADP
PDB Compounds: (B:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d4n5nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5nb_ c.2.1.0 (B:) automated matches {Ralstonia eutropha [TaxId: 381666]}
qriayvtggmggigtaicqrlakdgfrvvagcgpnsprrekwleqqkalgfdfiasegnv
adwdstktafdkvksevgevdvlinnagitrdvvfrkmtradwdavidtnltslfnvtkq
vidgmadrgwgrivnissvngqkgqfgqtnystakaglhgftmalaqevatkgvtvntvs
pgyiatdmvkairqdvldkivatipvkrlglpeeiasicawlsseesgfstgadfslngg
lhmg

SCOPe Domain Coordinates for d4n5nb_:

Click to download the PDB-style file with coordinates for d4n5nb_.
(The format of our PDB-style files is described here.)

Timeline for d4n5nb_: