Lineage for d4n37c_ (4n37 C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2235412Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2235413Protein automated matches [190159] (16 species)
    not a true protein
  7. 2235465Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)
  8. 2235613Domain d4n37c_: 4n37 C: [235732]
    automated match to d4n36b_
    complexed with ca, mma

Details for d4n37c_

PDB Entry: 4n37 (more details), 2 Å

PDB Description: structure of langerin crd i313 d288 complexed with me-man
PDB Compounds: (C:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d4n37c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n37c_ d.169.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl
tkagmegdwswvddtpfnkvqsarfwipgepndagnnehcgnikapslqawndapcditf
lfickrpyvp

SCOPe Domain Coordinates for d4n37c_:

Click to download the PDB-style file with coordinates for d4n37c_.
(The format of our PDB-style files is described here.)

Timeline for d4n37c_: