Lineage for d4n37b_ (4n37 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559900Domain d4n37b_: 4n37 B: [235730]
    automated match to d4n36b_
    complexed with ca, mma

Details for d4n37b_

PDB Entry: 4n37 (more details), 2 Å

PDB Description: structure of langerin crd i313 d288 complexed with me-man
PDB Compounds: (B:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d4n37b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n37b_ d.169.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigltk
agmegdwswvddtpfnkvqsarfwipgepndagnnehcgnikapslqawndapcditflf
ickrpyvp

SCOPe Domain Coordinates for d4n37b_:

Click to download the PDB-style file with coordinates for d4n37b_.
(The format of our PDB-style files is described here.)

Timeline for d4n37b_: