Lineage for d4n35d_ (4n35 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002480Domain d4n35d_: 4n35 D: [235723]
    automated match to d4n34d_
    complexed with ca

Details for d4n35d_

PDB Entry: 4n35 (more details), 1.85 Å

PDB Description: structure of langerin crd i313 complexed with glcnac-beta1-3gal-beta1- 4glc-beta-ch2ch2n3
PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d4n35d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n35d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywiglt
kagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcditfl
fickrpyv

SCOPe Domain Coordinates for d4n35d_:

Click to download the PDB-style file with coordinates for d4n35d_.
(The format of our PDB-style files is described here.)

Timeline for d4n35d_: