Lineage for d4n2yb_ (4n2y B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827471Species Archaeoglobus fulgidus [TaxId:2234] [228125] (2 PDB entries)
  8. 2827475Domain d4n2yb_: 4n2y B: [235720]
    automated match to d4muza_
    complexed with gol

Details for d4n2yb_

PDB Entry: 4n2y (more details), 1.55 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Archaeoglobus fulgidus
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4n2yb_:

Sequence, based on SEQRES records: (download)

>d4n2yb_ c.1.2.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpgigaqkgsieavky
adgiivgrgiyasgnpaeearklrrvlki

Sequence, based on observed residues (ATOM records): (download)

>d4n2yb_ c.1.2.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpieavkyadgiivgr
giyasgnpaeearklrrvlki

SCOPe Domain Coordinates for d4n2yb_:

Click to download the PDB-style file with coordinates for d4n2yb_.
(The format of our PDB-style files is described here.)

Timeline for d4n2yb_: