SCOPe 2.03: Domain d4n2yc_: 4n2y C:

Lineage for d4n2yc_ (4n2y C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.0: automated matches [191350] (1 protein)
   not a true family

6. Protein automated matches [190292] (20 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [228125] (2 PDB entries)

8. Domain d4n2yc_: 4n2y C: [235719]
   automated match to d4muza_
   complexed with gol

Details for d4n2yc_

PDB Entry: 4n2y, 1.55 Å

PDB Description: Crystal structure of orotidine 5'-monophosphate decarboxylase from Archaeoglobus fulgidus

PDB Compounds: (C:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d4n2yc_:

Sequence, based on SEQRES records:

>d4n2yc_ c.1.2.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpgigaqkgsieavky
adgiivgrgiyasgnpaeearklrrvlki

Sequence, based on observed residues (ATOM records):

>d4n2yc_ c.1.2.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mkqlilaldvmdgekameiakkvaehvdrikvnyplvlsagvgimkrlseikpviadfki
advpytssliariafensaesvivhgfvgsdtlrevcrvaeefggkvyavtelsspggee
fmsavslkivekakeagchgliapstrierlreirkaagdmeilcpieavkyadgiivgr
giyasgnpaeearklrrvlki

Timeline for d4n2yc_:

• d4n2yc_ is new in SCOPe 2.03-stable
  
• d4n2yc_ appears in SCOPe 2.04
  
• d4n2yc_ appears in the current release, SCOPe 2.08