Lineage for d4mzzb_ (4mzz B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261667Fold g.32: GLA-domain [57629] (1 superfamily)
    Calcium ion-bound
  4. 2261668Superfamily g.32.1: GLA-domain [57630] (2 families) (S)
    gamma-carboxy-glutamic acid-rich domain
  5. 2261669Family g.32.1.1: GLA-domain [57631] (7 proteins)
  6. 2261726Protein automated matches [229333] (1 species)
    not a true protein
  7. 2261727Species Cow (Bos taurus) [TaxId:9913] [229334] (1 PDB entry)
  8. 2261729Domain d4mzzb_: 4mzz B: [235709]
    automated match to d4mzza_

Details for d4mzzb_

PDB Entry: 4mzz (more details), 1.88 Å

PDB Description: Crystal structure of Bovine 3 Glu-Osteocalcin.
PDB Compounds: (B:) Osteocalcin

SCOPe Domain Sequences for d4mzzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mzzb_ g.32.1.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
epkrevcelnpdcdeladhigfqeayrrfygp

SCOPe Domain Coordinates for d4mzzb_:

Click to download the PDB-style file with coordinates for d4mzzb_.
(The format of our PDB-style files is described here.)

Timeline for d4mzzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4mzza_