Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.1: Sialidases (neuraminidases) [50940] (10 proteins) |
Protein automated matches [193245] (21 species) not a true protein |
Species Human parainfluenza 3 virus [TaxId:11217] [228816] (2 PDB entries) |
Domain d4mzea_: 4mze A: [235708] automated match to d4mzeb_ complexed with ca, edo, nag, peg, po4, so4; mutant |
PDB Entry: 4mze (more details), 1.8 Å
SCOPe Domain Sequences for d4mzea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mzea_ b.68.1.1 (A:) automated matches {Human parainfluenza 3 virus [TaxId: 11217]} rithdvgikplnpddfwrctsglpslmktpkirlmpgpgllampttvdgcvrtpslvind liyaytsnlitrgcqdigksyqvlqigiitvnsdlvpdlnprishtfnindnrkscslal lntdvyqlcstpkvdersdyassgiedivldivnhdgsisttrfknnnisfdqpyaalyp svgpgiyykgkiiflgygglehpinenaicnttgcpgktqrdcnqashspwfsdrrmvns iivvdkglnsipklkvwtismrqnywgsegrllllgnkiyiytrstswhsklqlgiidit dysdirikwtwhnvlsrpgnnecpwghscpdgcitgvytdayplnptgsivssvildsqk srvnpvityststervnelairnktlsagytttscithynkgycfhiveinqksldtfrp mlfkteipkscs
Timeline for d4mzea_: