SCOP 1.65: Domain d1ev11_: 1ev1 1:

Lineage for d1ev11_ (1ev1 1:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein Human enterovirus B coat proteins [88635] (4 species)

7. Species Human echovirus 1 [TaxId:46633] [49685] (1 PDB entry)

8. Domain d1ev11_: 1ev1 1: [23570]
   complexed with myr, plm

Details for d1ev11_

PDB Entry: 1ev1, 3.55 Å

PDB Description: echovirus 1

SCOP Domain Sequences for d1ev11_:

Sequence; same for both SEQRES and ATOM records:

>d1ev11_ b.121.4.1 (1:) Human enterovirus B coat proteins {Human echovirus 1}
gdvqnavegamvrvadtvqtsatnservpnltavetghtsqavpgdtmqtrhvinnhvrs
estienflarsacvfyleyktgtkedsnsfnnwvittrrvaqlrrklemftylrfdmeit
vvitssqdqstsqnqnapvlthqimyvppggpipvsvddyswqtstnpsifwtegnapar
msipfisignaysnfydgwshfsqagvygfttlnnmgqlffrhvnkpnpaaitsvariyf
kpkhvrawvprpprlcpyinstnvnfepkpvtevrtniitt

Timeline for d1ev11_:

• d1ev11_ first appeared (with stable ids) in SCOP 1.55
  
• d1ev11_ appears in SCOP 1.63
  
• d1ev11_ appears in SCOP 1.67
  
• d1ev11_ appears in the current release, SCOPe 2.08