Class b: All beta proteins [48724] (126 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (7 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (9 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Human enterovirus B coat proteins [88635] (4 species) |
Species Human echovirus 1 [TaxId:46633] [49685] (1 PDB entry) |
Domain d1ev11_: 1ev1 1: [23570] complexed with myr, plm |
PDB Entry: 1ev1 (more details), 3.55 Å
SCOP Domain Sequences for d1ev11_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ev11_ b.121.4.1 (1:) Human enterovirus B coat proteins {Human echovirus 1} gdvqnavegamvrvadtvqtsatnservpnltavetghtsqavpgdtmqtrhvinnhvrs estienflarsacvfyleyktgtkedsnsfnnwvittrrvaqlrrklemftylrfdmeit vvitssqdqstsqnqnapvlthqimyvppggpipvsvddyswqtstnpsifwtegnapar msipfisignaysnfydgwshfsqagvygfttlnnmgqlffrhvnkpnpaaitsvariyf kpkhvrawvprpprlcpyinstnvnfepkpvtevrtniitt
Timeline for d1ev11_: